CN
Search Within
850345P
应用筛选条件
关键词:'850345P'
显示 1-30 共 116 条结果 关于 "850345P" 范围 论文
Randi Nordström et al.
Journal of colloid and interface science, 562, 322-332 (2019-12-20)
In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 ([LL-37, 37 aa]) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta
Qing Wang et al.
Biophysical journal, 115(4), 664-678 (2018-08-08)
Using Förster resonance energy transfer, raft/liquid-ordered-domain formation was assessed in asymmetric vesicles containing outer leaflets composed of high-Tm (melting temperature) saturated phosphatidylcholines (diC18:0PC, diC16:0PC, diC15:0PC, or diC14:0PC), low-Tm unsaturated dioleoylphosphatidylcholine (DOPC) and cholesterol, and inner leaflets composed of lipids that
Patty Wong et al.
Bioconjugate chemistry (2020-01-22)
Lipid nanodiscs (LNDs), comprising a phospholipid bilayer encircled by two molecules of a recombinant membrane scaffold protein, can be targeted to tumors with covalently attached antibodies (Abs) or their fragments. Antibody attachment to click chemistry based PEGylated lipids on LNDs
Matthias Pauthner et al.
Immunity, 46(6), 1073-1088 (2017-06-22)
The development of stabilized recombinant HIV envelope trimers that mimic the virion surface molecule has increased enthusiasm for a neutralizing antibody (nAb)-based HIV vaccine. However, there is limited experience with recombinant trimers as immunogens in nonhuman primates, which are typically
Songlei Zhou et al.
Biomaterials, 235, 119795-119795 (2020-02-06)
Efficient delivery of vaccines to dendritic cells (DCs) is critical for inducing sufficient immune response and realizing effective cancer immunotherapy. In the past decade, researchers have spent tremendous effort in delivering vaccines by using nanoparticles. However, most of the present
Wei He et al.
Nanomedicine : nanotechnology, biology, and medicine, 24, 102154-102154 (2020-01-27)
In vivo delivery of large RNA molecules has significant implications for novel gene therapy, biologics delivery, and vaccine applications. We have developed cationic nanolipoprotein particles (NLPs) to enhance the complexation and delivery of large self-amplifying mRNAs (replicons) in vivo. NLPs
Hitoshi Matsuki et al.
Biochimica et biophysica acta. Biomembranes, 1862(5), 183197-183197 (2020-01-21)
The bilayer phase transitions of medium-chain phosphatidylcholines with linear saturated acyl chains (Cn = 12, 13 and 14) were measured by high-pressure light-transmittance measurements and differential scanning calorimetry to investigate the formation of intermediate gel-liquid crystalline phase called Lx phase. The constructed
Wookju Jang et al.
Molecules and cells, 31(5), 461-470 (2011-05-03)
Long-term consumption of artificial sweeteners (AS) has been the recent focus of safety concerns. However, the potential risk of the AS in cardiovascular disease and lipoprotein metabolism has not been investigated sufficiently. We compared the influence of AS (aspartame, acesulfame
Sungsoo Lee et al.
Journal of visualized experiments : JoVE, (77), e50436-e50436 (2013-07-31)
To study the lipid-protein interaction in a reductionistic fashion, it is necessary to incorporate the membrane proteins into membranes of well-defined lipid composition. We are studying the lipid-dependent gating effects in a prototype voltage-gated potassium (Kv) channel, and have worked
L Bakás et al.
Biophysical journal, 71(4), 1869-1876 (1996-10-01)
Alpha-Hemolysin is an extracellular protein toxin (107 kDa) produced by some pathogenic strains of Escherichia coli. Although stable in aqueous medium, it can bind to lipid bilayers and produce membrane disruption in model and cell membranes. Previous studies had shown
Assembly of streptolysin O pores assessed by quartz crystal microbalance and atomic force microscopy provides evidence for the formation of anchored but incomplete oligomers
Stewart SE, et al.
Biochimica et Biophysica Acta - Biomembranes, 1848(1), 115-126 (2015)
Erik F Kot et al.
Langmuir : the ACS journal of surfaces and colloids, 34(11), 3426-3437 (2018-02-28)
Isotropic phospholipid bicelles are one of the most prospective membrane mimetics for the structural studies of membrane proteins in solution. Recent works provided an almost full set of data regarding the properties of isotropic bicelles; however, one major aspect of
Nidal Muhanna et al.
Endocrine-related cancer, 27(2), 41-53 (2019-11-22)
The incidence of differentiated thyroid cancer has increased significantly during the last several decades. Surgical resection is the primary treatment for thyroid cancer and is highly effective, resulting in 5-year survival rates greater than 98%. However, surgical resection can result
Keitaro Sou et al.
Scientific reports, 9(1), 17991-17991 (2019-12-01)
Thermosensitive fluorescent dyes can convert thermal signals into optical signals as a molecular nanoprobe. These nanoprobes are playing an increasingly important part in optical temperature sensing and imaging at the nano- and microscale. However, the ability of a fluorescent dye
Maryam T Hussain et al.
International journal of pharmaceutics, 573, 118722-118722 (2019-11-11)
Technology such as the use of microfluidics to generate liposomes has been well researched, yet the stabilisation of liposomal formulations is a major challenge to their greater implementation. To the best of our knowledge, this is the first study investigating
Lydie Vamparys et al.
Biophysical journal, 104(3), 585-593 (2013-02-28)
In biological membranes, changes in lipid composition or mechanical deformations produce defects in the geometrical arrangement of lipids, thus allowing the adsorption of certain peripheral proteins. Here, we perform molecular dynamics simulations on bilayers containing a cylindrical lipid (PC) and
Arpita Roy et al.
Langmuir : the ACS journal of surfaces and colloids, 32(20), 5124-5134 (2016-05-03)
It is well-known that sugars protect membrane structures against fusion and leakage. Here, we have investigated the interaction between different sugars (sucrose, trehalose, and maltose) and phospholipid membrane of 1,2-dimyristoyl-sn-glycero-3-phoshpocholine (DMPC) using dynamic light scattering (DLS), transmission electron microscopy (TEM)
Sarah Waldie et al.
Langmuir : the ACS journal of surfaces and colloids, 34(1), 472-479 (2017-12-13)
Cholesterol is an essential component of mammalian membranes and is known to induce a series of physicochemical changes in the lipid bilayer. Such changes include the formation of liquid-ordered phases with an increased thickness and a configurational order as compared
Lukas Frey et al.
Journal of the American Chemical Society, 140(45), 15402-15411 (2018-10-06)
Membrane protein function fundamentally depends on lipid-bilayer fluidity and the composition of the biological membrane. Although dynamic interdependencies between membrane proteins and the surrounding lipids are suspected, a detailed description is still missing. To uncover lipid-modulated membrane protein backbone dynamics
Nishu Kanwa et al.
Physical chemistry chemical physics : PCCP, 22(6), 3234-3244 (2020-01-30)
In the present contribution, we investigate the interactions of lipid bilayer membranes of different charges and different phase states with aliphatic amino acids of varying charge (aspartic acid, glutamic acid, arginine and lysine) and hydrophobicity (serine, leucine and valine) by
Graham J Taylor et al.
Langmuir : the ACS journal of surfaces and colloids, 33(38), 10016-10026 (2017-08-16)
In-plane lipid organization and phase separation in natural membranes play key roles in regulating many cellular processes. Highly cooperative, first-order phase transitions in model membranes consisting of few lipid components are well understood and readily detectable via calorimetry, densitometry, and
Nabanita Das et al.
Nature protocols, 8(11), 2256-2270 (2013-10-26)
Solid-state NMR spectroscopy has been used successfully for characterizing the structure and dynamics of membrane proteins as well as their interactions with other proteins in lipid bilayers. Such an environment is often necessary for achieving native-like structures. Sample preparation is
Sofia Movérare-Skrtic et al.
Nature medicine, 20(11), 1279-1288 (2014-10-13)
The WNT16 locus is a major determinant of cortical bone thickness and nonvertebral fracture risk in humans. The disability, mortality and costs caused by osteoporosis-induced nonvertebral fractures are enormous. We demonstrate here that Wnt16-deficient mice develop spontaneous fractures as a
Giovanna D'Angelo et al.
The journal of physical chemistry. B, 121(6), 1204-1210 (2017-01-25)
Fast thermal fluctuations and low frequency phonon modes are thought to play a part in the dynamic mechanisms of many important biological functions in cell membranes. Here we report a detailed far-infrared study of the molecular subpicosecond motions of phospholipid
Ling Han et al.
Analytical chemistry, 89(17), 9330-9338 (2017-08-03)
This work describes a versatile analytical approach, which combines the proxy ligand electrospray ionization mass spectrometry (ESI-MS) assay and model membranes of defined composition, to quantify the influence of lipid bilayer composition on protein-glycolipid binding in vitro. To illustrate the
Stephen M Baumler et al.
Langmuir : the ACS journal of surfaces and colloids, 33(12), 2986-2992 (2017-03-08)
The translational diffusion dynamics of the zwitterionic lipid 1,2-dimyristoyl-sn-glycero-3-phosphocholine (DMPC) at a planar phosphorylated support surface containing metal ions (Mg2+, Ca2+, Ba2+, Ni2+, Zn2+, Cd2+, Zr4+) was investigated using X-ray photoelectron spectroscopy (XPS) and fluorescence recovery after photobleaching (FRAP). Fluorescence
Idalia M Sandoval-Jiménez et al.
The Journal of chemical physics, 152(1), 014901-014901 (2020-01-10)
We present a method that takes advantage of the Brownian motion of a colloidal particle to experimentally determine the area stretch modulus of giant liposomes in solution, in regard to the continuum mechanics theory of elasticity. The characteristic parameters of
DeeAnn K Asamoto et al.
Biophysical journal, 118(2), 403-414 (2019-12-18)
Nanodiscs (NDs) are an excellent alternative to small unilamellar vesicles (SUVs) for studies of membrane protein structure, but it has not yet been shown that membrane proteins are able to spontaneously fold and insert into a solution of freely diffusing
Amir Abbas Momtazi-Borojeni et al.
BMC medicine, 17(1), 223-223 (2019-12-11)
Proprotein convertase subtilisin/kexin 9 (PCSK9) is an important regulator of low-density lipoprotein receptor (LDLR) and plasma levels of LDL cholesterol (LDL-C). PCSK9 inhibition is an efficient therapeutic approach for the treatment of dyslipidemia. We tested the therapeutic effect of a
Rosana Ribić et al.
The journal of physical chemistry. B, 124(20), 4132-4145 (2020-04-15)
We present an in-depth investigation of the membrane interactions of peptidoglycan (PGN)-based immune adjuvants designed for lipid-based delivery systems using NMR spectroscopy. The derivatives contain a cargo peptidoglycan (PGN) dipeptide fragment and an adamantyl group, which serves as an anchor
1/4