biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL
immunogen sequence
VLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CREB3(10488)
General description
CREB3 (CAMP responsive element binding protein 3) is also termed as luman/leucine zipper protein (LZIP). It is a basic leucine zipper transcription factor of the CREB/ATF gene family. It consists of a potent N-terminal acidic activation domain and a basic-leucine zipper motif (bZIP). It is located on human chromosome 9p13.3.
Immunogen
cAMP responsive element binding protein 3
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
CREB3 (CAMP responsive element binding protein 3) induces atherosclerosis through matrix metallopeptidase 9 (MMP-9) transcription and vascular smooth muscle cell migration. Hence, it is considered as a therapeutic target molecule for the treatment of atherosclerosis. CREB3 participates in the modulation of cell growth.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Other Notes
Corresponding Antigen APREST89296
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
存储类别
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
法规信息
新产品
此项目有
Luman, the cellular counterpart of herpes simplex virus VP16, is processed by regulated intramembrane proteolysis
Raggo C, et al.
Molecular and Cellular Biology, 22(16), 5639-5649 (2002)
Multiple pathways in the FGF signaling network are frequently deregulated by gene amplification in oral dysplasias
Tsui I F L, et al.
International Journal of Cancer. Journal International Du Cancer, 125(9), 2219-2228 (2009)
Jeonghan Kim et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 28(11), 5010-5021 (2014-08-01)
Atherosclerosis is a chronic inflammatory response of the vascular wall, and immune responses are involved in every phase of atherosclerosis, from initiation, to progression, and finally to plaque rupture. Cytokines are the major atherogenic mediators that promote plaque formation and
全球贸易项目编号
| 货号 | GTIN |
|---|---|
| HPA030978-100UL | 04061831749786 |
| HPA030978-25UL | 04061842982462 |