Monoclonal Anti-SFN antibody produced in mouse

Stratifin (SFN), a cell cycle checkpoint protein, is expressed at low levels on the nervous and reproductive systems, like the cortex, retina, placenta, and ovary.

SFN (AAH00329.1, 1 a.a. ~ 248 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKAETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Monoclonal Anti-SFN antibody produced in mouse has been used in immunohistochemistry (1:200).

Stratifin (SFN) plays a key role in oncogenesis. It regulates mitotic translation. SFN frequently inhibits DNA errors during mitosis as a reaction to DNA damage. It acts as a potential biomarker in various cancers.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.