Skip to Content
Merck
CN

HPA007641

Anti-FER antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Proto-oncogene tyrosine-protein kinase FER antibody produced in rabbit, Anti-Tyrosine kinase 3 antibody produced in rabbit, Anti-c-FER antibody produced in rabbit, Anti-p94-FER antibody produced in rabbit

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
8
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:200-1:500

immunogen sequence

QVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FER(2241)

General description

FER (fer (fps/fes related) tyrosine kinase) gene encodes a non-transmembrane receptor tyrosine kinase belonging to the FPS/FES family. The protein has a molar mass of 94kDa and contains a short, basic C-terminal tail and a large N-terminal hydrophilic domain that is similar to the 92kDa protein encoded by the mammalian c-fps/fes proto-oncogene. It contains a single SH2 domain.

Immunogen

Proto-oncogene tyrosine-protein kinase FER recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

FER (fer (fps/fes related) tyrosine kinase) contains a coiled coil sequence that interacts with a catenin-like substrate pp120 and mediates cell-cell signaling. It is localized to the cytoplasmic fraction and interacts with actin-binding protein cortactin to form a complex. It functions in the growth factor-dependent phosphorylation of cortactin and mediates signaling from the cell surface to the cytoskeleton. The Fer protein that is localized on microtubules phosphorylates platelet endothelial cell adhesion molecule-1, a part of intercellular junctions that mediates intracellular signaling cascades. It phosphorylates plakoglobin, a protein that links E-cadherin and α-catenin, and enhances the binding of plakoglobin to α-catenin, thereby increasing the transcriptional activity of the β-catenin-Tcf-4 complex that is commonly found in many epithelial tumor cells. It mediates phosphorylation of focal adhesion kinase in suspended hepatocytes leading to multiple membrane protrusions and regulation of cell morphology.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST71432

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

低风险生物材料
常规特殊物品

This item has



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library


Related Content

Prestige Antibodies Immunofluorescence Procedure


Kensuke Mitsunari et al.
Oncology letters, 13(2), 834-840 (2017-03-31)
Fps/Fes related (Fer) is a non-receptor tyrosine kinase that is expressed in fibroblasts, immune cells and endothelial cells. Fer serves an important pathological role in cell survival, angiogenesis and the immune system. However, the pathological role of Fer expression in
Susana Miravet et al.
Molecular and cellular biology, 23(20), 7391-7402 (2003-10-01)
Plakoglobin is a protein closely related to beta-catenin that links desmosomal cadherins to intermediate filaments. Plakoglobin can also substitute for beta-catenin in adherens junctions, providing a connection between E-cadherin and alpha-catenin. Association of beta-catenin with E-cadherin and alpha-catenin is regulated
T Pawson et al.
Molecular and cellular biology, 9(12), 5722-5725 (1989-12-01)
We have recently isolated human and rat cDNAs (designated FER and flk, respectively) which encode nonreceptor protein-tyrosine kinases which are very similar to one another and related in sequence and domain structure to the c-fps/fes gene product. We show that



Global Trade Item Number

SKUGTIN
HPA007641-100UL04061837124204
HPA007641-25UL04061842789351