Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
4
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunohistochemistry: 1:200- 1:500
immunogen sequence
AEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEEPDPLPDNWEMA
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... MAGI2(9863)
General description
The gene MAGI2 (membrane associated guanylate kinase, WW and PDZ domain containing 2) is mapped to human chromosome 7q21 and spans 1.4 megabases. It contains 21 exons encoding a 2410 amino acid protein that contains nine potential protein-protein interaction domains. These domains include one Guk (guanylate kinase-like) domain, two WW domains and six PDZ domains.
Immunogen
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Application
Anti-MAGI2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
The gene MAGI2 (membrane associated guanylate kinase, WW and PDZ domain containing 2) encodes a scaffolding protein that functions in the assembly of epithelial tight junction enhancing epithelial integrity. It negatively regulates cell migration and proliferation via PTEN (phosphatase and tensin homolog), a protein involved in cell growth and apoptosis. It has been implicated in celiac disease and ulcerative colitis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST72647
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Explore all of our products under Anti-MAGI2 antibody produced in rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 1
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Regulatory Information
常规特殊物品
低风险生物材料
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Genitourinary Pathology.
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc, 29 Suppl 2, 212-272 (2016-01-29)
Genitourinary Pathology.
Laboratory investigation; a journal of technical methods and pathology, 96 Suppl 1, 212-272 (2016-01-28)
Dermot P B McGovern et al.
Inflammatory bowel diseases, 15(1), 75-83 (2008-08-23)
Despite recent advances the majority of inflammatory bowel disease (IBD) susceptibility 'genes' remain undiscovered. Recent data suggest that autoimmune conditions may 'share' susceptibility loci. Epidemiological evidence indicates an association between celiac disease and IBD and both conditions demonstrate increased gut
Global Trade Item Number
| SKU | GTIN |
|---|---|
| HPA013650-100UL | 04061837136641 |
| HPA013650-25UL | 04061842792597 |