Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
Conjugate:
unconjugated
Clone:
7F3, monoclonal
Application:
ELISA (i), IHC (p), PLA, WB
Citations:
7
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
7F3, monoclonal
form
buffered aqueous solution
species reactivity
human, rat
technique(s)
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, indirect ELISA: suitable, proximity ligation assay: suitable, western blot: 1-5 μg/mL
isotype
IgG1κ
UniProt accession no.
application(s)
research pathology
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SMAD3(4088)
General description
Mothers against decapentaplegic homolog 3 (SMAD3) protein is an important constituent of the transforming growth factor-beta (TGF-β) signaling pathway. Mad homology 1 (MH1) and Mad homology 2 (MH2) are the two functional domains of the SMAD3. The SMAD3 gene is located on human chromosome 15q22.33.
Immunogen
SMAD3 (NP_005893, 120 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDL
Sequence
VCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDL
Application
Monoclonal Anti-SMAD3 antibody produced in mouse has been used in immunohistochemistry (1:200).
Biochem/physiol Actions
Mothers against decapentaplegic homolog 3 (SMAD3) protein possesses tumor-suppressive actions. It is involved in epithelial to mesenchymal transition (EMT). SMAD3 also possesses tumor-promoting actions of transforming growth factor-beta (TGF-β). The N-terminal domain Mad homology 1 (MH1) of SMAD3 plays a role in DNA binding. The SMAD3 gene mutation is linked to an increased incidence of knee osteoarthritis. DNA methylation change in the SMAD3 gene promoter is associated with atopic asthma. SMAD3 protein plays a regulatory role in immune responses. It also modulates fibrosis in the airways.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Explore all of our products under Monoclonal Anti-SMAD3 antibody produced in mouse
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Bertrand Chesneau et al.
Molecular genetics & genomic medicine, 8(5), e1132-e1132 (2020-03-11)
Pathogenic SMAD3 variants are responsible for a cardiovascular phenotype, mainly thoracic aortic aneurysms and dissections. Precocious identification of the vascular risk such as aortic dilatation in mutated patients has a major impact in terms of management, particularly to avoid dissection
Astrid Jeibmann et al.
Journal of neuro-oncology, 131(3), 477-484 (2017-01-22)
Atypical teratoid/rhabdoid tumors (ATRT) are highly malignant brain tumors arising in young children. The majority of ATRT is characterized by inactivation of the chromatin remodeling complex member SMARCB1 (INI1/hSNF5). Little is known, however, on downstream pathways involved in the detrimental
Tianli Cheng et al.
International journal of oncology, 45(5), 1977-1988 (2014-09-02)
Altered expression of miRNAs contributes to development and progression of non-small cell lung cancer (NSCLC), while transforming growth factor-β (TGF-β) promotes NSCLC cell epithelial-mesenchymal transition. This study aimed to investigate the effects of TGF-β-induced miR‑143 expression in regulation of NSCLC
Global Trade Item Number
| SKU | GTIN |
|---|---|
| SAB1400160-100UG | 04061831651386 |