Monoclonal Anti-ITGA2 antibody produced in mouse

Integrin α2 (ITGA2) is a collagen receptor that is present on the platelets and epithelial cells. This protein is highly expressed in normal epithelial cells. The ITGA2 gene is located on the human chromosome at 5q11.2.

ITGA2 (NP_002194.2, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL

Integrin α2 subunit (ITGA2) plays a role in angiogenesis, cell migration, invasion, and cell survival. This protein acts as a tumor activator in several tumors. ITGA2 protein might be involved in cell adhesion and cell-surface mediated signaling and is highly expressed in several cancers. Overexpression of the ITGA2 gene is observed in pancreatic ductal adenocarcinoma and ovarian cancer.

Integrin subunit α 2 (ITGA2) functions as a platelet receptor of collagen, which is an important activating agent required for platelet aggregation. Mutation in the gene might lead to aspirin insensitivity mainly in Chinese populations and in aspirin semi-resistance. Integrin α2β1 serves as a receptor for collagen and many other extracellular matrix (ECM) complexes. Variation in the gene elevates the expression of α2β1 on platelets and increase the risk of having melanoma, gastric, ovarian cancer, thrombosis, myocardial infarction and stroke. Thus, Integrin α2β1 acts as a potential therapeutic target for thrombosis related diseases, cancer, and inflammation. Cryptosporidium parvum infection, elevates the expression of ITGA2 in the host cell. Therefore, silencing the expression of the ITGA2 by using specific antibodies and the ligand type I collagen (collagen-I), is considered as a promising therapeutic method for treatment of cryptosporidial infection.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.