Monoclonal Anti-TOMM20 antibody produced in mouse

Translocase of outer mitochondrial membrane 20 (TOMM20) is a 20kb gene with five exons and four introns, and is mapped to human chromosome 1q42.3. This gene codes for a TOMM20 receptor, which is a subunit of the outer mitochondrial membrane translocase. TOMM20 receptor contains a membrane anchor domain and a cytosolic domain, and is predominantly expressed in human cochlea.

TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Translocase of outer mitochondrial membrane 20 (TOMM20) is a subunit of multiple component- dynamic complex, which plays a vital role in importing certain cytosolic proteins into or through the outer membrane of the mitochondria. It acts as a receptor for precursor proteins containing N-terminal cleavable presequences targeted to the mitochondria. Nuclear respiratory factor 2(NRF-2) plays an essential role in regulating transcription of the human TOMM20 gene. TOMM20 has potential as a prognostic biomarker and therapeutic target for gastric cancer. TOMM20 serve as a marker for mitochondrial protein import in inner ear, and reduced expression of TOMM20 is associated with Meniere′s disease.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.